5-Min Pizza English Muffin
Split an English muffin, top with pizza sauce and melted mozzarella, then broil until the cheese bubbles. A crispy, cheesy breakfast toast ready in minutes.
- Total time
- 5 min
- Servings
- 1
- Calories
- 280
- Protein
- 12g
quickcasualamericanvegetariancrispymeltyweeknightbreakfast
Ingredients
- 1 whole English muffin
- 3 tbsp pizza sauce
- ½ cup mozzarella cheese, shredded
Instructions
- 1
Split the English muffin in half and place cut-side up on a small baking sheet.
- 2
Spread 1.5 tablespoons pizza sauce on each muffin half, then top with cheese.
- 3
Broil 3–4 minutes until the cheese bubbles and edges turn golden.
- 4
Remove from the broiler and cool 30 seconds before eating.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
