Cheesy Pizza Bagel
Split a bagel, top with pizza sauce and melted mozzarella, then broil until the cheese bubbles and browns. A 10-minute breakfast or snack that tastes like pizza but eats like toast.
- Total time
- 10 min
- Servings
- 1
- Calories
- 380
- Protein
- 16g
quickcasualamericanvegetariancheesecrispymeltyweeknight
Ingredients
- 1 whole bagel
- 3 tbsp pizza sauce
- ½ cup mozzarella cheese, shredded
Instructions
- 1
Split the bagel in half and place cut-side up on a small baking sheet.
- 2
Spread 1.5 tbsp pizza sauce on each bagel half.
- 3
Top each half with 1/4 cup mozzarella, piling it slightly in the center.
- 4
Broil on the middle rack for 3-4 minutes until cheese is bubbly and edges brown.
- 5
Let cool 1 minute, then serve hot.
Tools you’ll need
- small baking sheet
- oven broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
