5-Min Naan Pizza
Crispy naan bread topped with pizza sauce, melted mozzarella, and fresh basil — ready in minutes. No oven required; just a skillet or toaster oven.
- Total time
- 5 min
- Servings
- 1
- Calories
- 320
- Protein
- 12g
casualquickamericanvegetariancrispymeltyweeknightquick
Ingredients
- 1 piece naan bread
- 3 tbsp pizza sauce
- ½ cup mozzarella cheese, shredded
- 4 leaves fresh basil leaves
Instructions
- 1
Heat a skillet over medium-high until water droplets sizzle on contact.
- 2
Place naan in the skillet and toast 60 seconds until the bottom browns slightly.
- 3
Flip the naan, then spread pizza sauce evenly across the cooked side.
- 4
Sprinkle mozzarella over the sauce and cover the skillet for 90 seconds until cheese melts.
- 5
Slide onto a plate, tear basil leaves over the top, and serve immediately.
Tools you’ll need
- 10-inch skillet
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
