CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Mozzarella Tomato Panini

A warm, melty press of fresh mozzarella, ripe tomato, and basil pesto on crusty bread—ready in 10 minutes. Toast it in a skillet until the bread is golden and the cheese flows.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Crispy Mozzarella Tomato Panini
casualquickamericanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 slices bread (ciabatta or sourdough, sliced)
  • 4 oz fresh mozzarella
  • 1 medium tomato (ripe, sliced)
  • 2 tbsp pesto

Instructions

  1. 1

    Spread 1 tbsp pesto on one bread slice, then layer half the mozzarella and tomato on top.

  2. 2

    Top with a second bread slice, pesto side down, pressing gently.

  3. 3

    Repeat with remaining bread, pesto, mozzarella, and tomato to make a second sandwich.

  4. 4

    Heat a skillet over medium-high until a water drop sizzles on contact.

  5. 5

    Place sandwiches in the skillet and press gently with a spatula 3–4 minutes until bread turns golden.

  6. 6

    Flip and toast the other side 2–3 minutes until cheese melts and bread crisps.

Tools you’ll need

  • chef's knife
  • cutting board
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.