20-Min Sausage Marinara Spaghetti
Crumbled Italian sausage browned with marinara sauce, tossed with spaghetti and finished with Parmesan. A weeknight staple that tastes restaurant-ready in 20 minutes.
- Total time
- 20 min
- Servings
- 4
- Calories
- 640
- Protein
- 38g
comfortamericanporktendercreamyweeknightpastadinner
Ingredients
- 1 lb spaghetti
- 1 lb Italian sausage, casings removed
- 24 oz marinara sauce
- ½ cup Parmesan cheese, grated
Instructions
- 1
Boil spaghetti in salted water until al dente, about 10 minutes.
- 2
While pasta cooks, brown sausage in a large skillet over medium-high, breaking up with a spoon, 6–8 minutes.
- 3
Pour marinara sauce into the skillet and simmer 3 minutes until warmed through.
- 4
Drain pasta and add it to the skillet, tossing to coat.
- 5
Divide among bowls and top with Parmesan.
Tools you’ll need
- large pot for pasta water
- large skillet (12-inch preferred)
- wooden spoon
- colander
- serving bowls
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
