5-Minute Naan Pizza
Crispy naan topped with warm pizza sauce, melted mozzarella, and fresh basil. A personal pizza that's ready before you finish pouring a drink.
- Total time
- 5 min
- Servings
- 1
- Calories
- 380
- Protein
- 14g
quickcasualamericanvegetariancrispymeltyweeknightsnack
Ingredients
- 1 piece naan
- 3 tbsp pizza sauce
- ½ cup mozzarella cheese, shredded
- 4 leaves fresh basil
Instructions
- 1
Heat a skillet over medium-high until water flicks sizzle on the surface.
- 2
Place naan in the skillet and cook 1 minute until the bottom starts to brown.
- 3
Flip the naan, then spread pizza sauce evenly over the top.
- 4
Scatter mozzarella over the sauce and cook 2 minutes until cheese melts.
- 5
Tear basil leaves and scatter over the melted cheese, then slide onto a plate.
Tools you’ll need
- 10-inch skillet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
