10-Min Cheesy Pita Pizza
Crispy pita bread topped with pizza sauce, melted mozzarella, and mushrooms — ready in minutes. Perfect weeknight snack or quick lunch.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 14g
quickcasualamericanvegetariancrispymeltyweeknightsnack
Ingredients
- 2 rounds pita bread
- ½ cup pizza sauce
- 1 cup mozzarella cheese, shredded
- 1 cup sliced mushrooms
Instructions
- 1
Place pita rounds on a baking sheet and spread pizza sauce evenly across each.
- 2
Scatter mushroom slices over the sauce, then top with shredded mozzarella.
- 3
Broil 4 inches from heat for 3–4 minutes until cheese melts and edges crisp.
- 4
Remove and let cool 1 minute before serving.
Tools you’ll need
- baking sheet
- oven broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
