CookSnap is coming soon — Join the waitlist →

Perfect Home Latte

Silky espresso and steamed milk with microfoam, no barista required. Heat, froth, pour—done in under 5 minutes.

Total time
5 min
Servings
1
Calories
160
Protein
8g
Perfect Home Latte
cozyenergizingitalianvegetariancreamysilkyweeknightmorning

Ingredients

  • 2 shots espresso
  • 8 oz whole milk
  • ½ tsp sugar
  • ¼ tsp salt

Instructions

  1. 1

    Brew 2 shots of espresso (or 1 shot if using a small cup) directly into a ceramic mug.

  2. 2

    Heat milk in a small saucepan over medium-high until steaming, ~2 minutes. Watch for wisps of steam—do not boil.

  3. 3

    Pour milk into a frothing pitcher and froth by plunging a milk frother up and down until foam rises to the pitcher rim, ~30 seconds.

  4. 4

    Pour steamed milk into the espresso, holding back the foam with a spoon, then top with 0.5 inch of microfoam.

  5. 5

    Serve immediately while the foam is still glossy and the milk is hot.

Tools you’ll need

  • espresso machine or stovetop moka pot
  • small saucepan
  • ceramic mug
  • milk frother or French press
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.