5-Minute Latte at Home
Silky espresso and steamed milk in under 5 minutes — no fancy machine needed. The secret is frothing technique and hot milk that transforms into café-quality foam.
- Total time
- 5 min
- Servings
- 1
- Calories
- 155
- Protein
- 8g
cozyenergizingitalianvegetariancreamysilkyweeknightbrunch
Ingredients
- 1 double shot (or 2 oz strong coffee) espresso shots or strong brewed coffee
- 8 oz whole milk
- ½ tbsp (or to taste) sugar
Instructions
- 1
Pour espresso or strong coffee into a mug. Add sugar if desired and stir well.
- 2
Heat milk in a small saucepan or microwave until steaming hot, ~120°F or until wisps of steam rise.
- 3
Pour hot milk into the espresso, holding back the foam with a spoon to create a thin stream first.
- 4
Top with a spoonful of milk foam and serve immediately.
Tools you’ll need
- mug or coffee cup
- small saucepan or microwave-safe pitcher
- spoon
- thermometer (optional but helpful)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
