Café Latte That Slaps
Silky espresso meets steamed milk and a delicate foam crown — the original TikTok coffee moment. Takes 5 minutes, tastes like the café down the street.
- Total time
- 5 min
- Servings
- 1
- Calories
- 120
- Protein
- 4g
cozyelegantitalianvegetariancreamysilkyweeknightbrunch
Ingredients
- 1 shot (1–1.5 oz) espresso (or strong brewed coffee)
- 8 oz whole milk
- ½ tbsp sugar or honey
Instructions
- 1
Pull 1–1.5 oz espresso into a warm ceramic cup. Add sweetener if desired.
- 2
Heat milk in a steaming pitcher to 150–155°F, or heat in microwave 60–90 seconds until steaming (not boiling).
- 3
Pour hot milk into espresso, tilting the cup and aiming for a thin layer of foam on top.
- 4
Serve immediately. The crema and foam should create a delicate coffee crown.
Tools you’ll need
- espresso machine (or moka pot / Aeropress for strong coffee)
- ceramic or glass cup (8–12 oz)
- milk steaming pitcher or small saucepan
- thermometer (optional but helpful)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
