Perfect Latte With Milk Foam
Espresso meets steamed milk in a silky latte you can make at home without a machine. Pull a rich shot, steam the milk until it froths, and pour for that viral latte-art look.
- Total time
- 5 min
- Servings
- 1
- Calories
- 120
- Protein
- 7g
cozysimpleitaliansilkycreamyairyweeknightmorning
Ingredients
- 2 oz espresso or strong brewed coffee
- 10 oz whole milk
- ½ tsp sugar
Instructions
- 1
Pull or brew 2 oz of espresso (or strong coffee) into a ceramic cup.
- 2
Heat 10 oz of milk in a small saucepan over medium heat until steaming, ~2 minutes.
- 3
Whisk the hot milk vigorously for 30 seconds until foamy bubbles form on top.
- 4
Pour the steamed milk into the espresso, holding back the foam with a spoon.
- 5
Top with a layer of milk foam and a pinch of sugar if desired.
Tools you’ll need
- ceramic cup
- small saucepan
- whisk
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
