Custrd is out on the App Store — Download it free →
Back to recipes

Penne with Bacon and Cream

A quick and creamy pasta dish with crispy bacon bits, ready in about 20 minutes. Perfect for a busy weeknight.

Total time
20 min
Servings
2
Calories
720
Protein
22g
Penne with Bacon and Cream
comfortingItalian-Americanporkcreamycrispyweeknightpastadinner

Ingredients

  • 8 oz penne pasta
  • 4 slices bacon
  • 1 cup heavy cream
  • 2 cloves garlic
  • ½ cup parmesan cheese
  • 1 tsp salt

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add the 8 oz penne and cook until al dente, about 11 minutes. Reserve 1/2 cup pasta water, then drain.

  2. 2

    While pasta cooks, chop the 4 slices bacon into small pieces. Cook in a large skillet over medium heat until crispy, about 8 minutes. Remove bacon with a slotted spoon, leaving 1 tbsp drippings.

  3. 3

    Mince the 2 garlic cloves and sauté in the bacon drippings over medium heat until fragrant, about 1 minute. Pour in the 1 cup heavy cream and bring to a simmer, stirring often, until slightly thickened, about 3 minutes.

  4. 4

    Add the cooked penne, crispy bacon, and 1/2 cup grated parmesan to the skillet. Toss to coat, adding reserved pasta water a splash at a time if the sauce is too thick. Season with the 1 tsp salt and serve hot.

Tools you’ll need

  • Large pot
  • Large skillet
  • Colander
  • Measuring cups and spoons
  • Knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.