CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Peach Strudel with Flaky Pastry

Store-bought puff pastry wrapped around spiced peaches and berries, baked until golden and crispy. A TikTok-easy Austrian classic that tastes like you spent hours but takes 10 minutes of actual work.

Total time
20 min
Servings
2
Calories
285
Protein
4g
20-Min Peach Strudel with Flaky Pastry
elegantindulgentaustrianvegetariancrispyflakytenderweeknight

Ingredients

  • 1 sheet (about 9x10 inches) puff pastry sheet, thawed
  • 2 medium, sliced fresh peaches (or frozen, thawed)
  • ½ cup mixed berries (raspberries, blackberries, or blueberries)
  • 2 tbsp granulated sugar
  • ¼ tsp ground cinnamon
  • ½ egg egg, beaten (for egg wash)

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. 2

    Toss peach slices and berries with sugar and cinnamon in a bowl until coated.

  3. 3

    Unroll puff pastry on the sheet pan. Arrange fruit down the center, leaving 1.5 inches on each side.

  4. 4

    Fold pastry edges over the fruit, overlapping slightly to create a rustic log. Brush with beaten egg.

  5. 5

    Bake 12-14 minutes until pastry is golden brown and crispy on all edges.

  6. 6

    Cool 2 minutes on the pan, then slide onto a plate and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.