CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Pão de Queijo Cheese Bread Balls

Crispy-outside, chewy-inside cheese bread balls that come together in one bowl and bake in 15 minutes. Pure Brazilian comfort — no yeast, no wait.

Total time
20 min
Servings
4
Calories
320
Protein
12g
20-Min Pão de Queijo Cheese Bread Balls
comfortsimplebrazilianvegetariancheesecrispychewyfluffy

Ingredients

  • 1.5 cups tapioca starch
  • ¾ cup whole milk
  • 2 whole large eggs
  • 1 cup shredded Parmesan or Minas cheese
  • 3 tbsp olive oil
  • ¾ tsp salt

Instructions

  1. 1

    Preheat oven to 400°F. Line a sheet pan with parchment or lightly oil it.

  2. 2

    Combine milk, eggs, and olive oil in a bowl, then whisk until smooth.

  3. 3

    Add tapioca starch, cheese, and salt to the wet mix, stirring until a thick dough forms.

  4. 4

    Scoop dough into golf-ball-sized portions and arrange on the sheet pan.

  5. 5

    Bake for 12–15 minutes until golden and puffed, centers should still be slightly soft.

  6. 6

    Serve warm. They're best eaten fresh, straight from the oven.

Tools you’ll need

  • sheet pan (9x13 or larger)
  • parchment paper or oil
  • mixing bowl
  • whisk
  • measuring cups and spoons
  • spoon or ice-cream scoop

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Brazilian recipes →