CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Pancit Canton with Fresh Sides

Stir-fried egg noodles with soy, garlic, and crispy edges, served alongside cool cucumber, tomato, and lettuce for a Filipino weeknight dinner that comes together in one pan.

Total time
20 min
Servings
2
Calories
380
Protein
10g
20-Min Pancit Canton with Fresh Sides
casualcomfortfilipinovegetarianvegetariancrispytenderweeknight

Ingredients

  • 8 oz fresh egg noodles or ramen noodles
  • 3 tbsp soy sauce
  • 4 cloves garlic, minced
  • 1 medium carrot, sliced into thin matchsticks
  • 2 cups cabbage, shredded
  • 1 medium cucumber, sliced thin
  • 1 medium tomato, sliced thin

Instructions

  1. 1

    Boil noodles in salted water until al dente, then drain completely.

  2. 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 1 minute.

  3. 3

    Add minced garlic and cook 30 seconds until fragrant, then add carrot and cabbage.

  4. 4

    Stir-fry until vegetables soften, about 3 minutes, then add cooked noodles and soy sauce.

  5. 5

    Toss constantly until noodles are heated through and edges start to crisp, 2–3 minutes.

  6. 6

    Divide pancit between plates and arrange cucumber slices, tomato slices, and lettuce alongside.

Tools you’ll need

  • large skillet or wok
  • pot for boiling
  • wooden spoon or tongs
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Filipino recipes →