Custrd is out on the App Store — Download it free →
Back to recipes

Pan-Seared Fish with Brussels Sprouts and Red Wine Reduction

A quick and elegant weeknight dinner featuring crispy-skinned fish fillets, caramelized Brussels sprouts, and a rich red wine reduction sauce.

Total time
20 min
Servings
2
Calories
450
Protein
35g
Pan-Seared Fish with Brussels Sprouts and Red Wine Reduction
elegantcomfortingAmericangluten-freefishcrispytenderweeknight dinner

Ingredients

  • 2 fillets fish fillets
  • 1 lb Brussels sprouts
  • ½ cup red wine
  • 2 tbsp butter
  • 2 tbsp olive oil
  • 1 pinch salt and pepper

Instructions

  1. 1

    Pat the 2 fish fillets dry and season both sides with salt and pepper. Trim and halve the 1 lb Brussels sprouts.

  2. 2

    Heat 1 tbsp olive oil in a large skillet over medium-high. Add the Brussels sprouts cut-side down and cook until deeply browned, about 5 minutes. Stir and cook 2 minutes more, then transfer to a plate.

  3. 3

    Add the remaining 1 tbsp olive oil to the skillet. Place the fish fillets skin-side down and cook until the skin is crisp and golden, about 4 minutes. Flip and cook until the fish is opaque and flakes easily, about 2 minutes more. Remove fish to a plate.

  4. 4

    Pour the 0.5 cup red wine into the skillet and scrape up any browned bits. Simmer until reduced by half, about 2 minutes. Whisk in the 2 tbsp butter until melted and glossy.

  5. 5

    Return the Brussels sprouts to the skillet to coat in the sauce. Serve the fish with the sprouts and spoon the red wine reduction over everything.

Tools you’ll need

  • large skillet
  • spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.