CookSnap is coming soon — Join the waitlist →

Normandy Fish Stew

A classic French seafood stew with white fish, mussels, and shrimp simmered in a light cream sauce with cider and herbs. Ready in under 30 minutes—elegant enough for dinner guests, simple enough for a weeknight.

Total time
25 min
Servings
2
Calories
385
Protein
42g
Normandy Fish Stew
elegantcozyfrenchfishshrimptendersilkyweeknight

Ingredients

  • ¾ lb white fish fillet (cod or halibut)
  • ½ lb mussels, debearded
  • ¼ lb shrimp, peeled and deveined
  • ¾ cup dry cider or dry white wine
  • ½ cup heavy cream
  • 2 whole shallots, thinly sliced
  • 2 tablespoon fresh thyme and parsley, chopped

Instructions

  1. 1

    Pat the fish fillet dry with paper towels, then lay it on a cutting board and slice it crosswise into 2-inch-wide pieces, like cutting bread into steaks.

  2. 2

    Place each shallot on a cutting board, cut it in half lengthwise from root to tip, then lay the flat side down and slice crosswise into thin half-moons about 1/8-inch thick.

  3. 3

    Heat a 12-inch skillet or shallow Dutch oven over medium heat, add 2 tablespoons olive oil, then add the sliced shallots and stir once every 15 seconds until they are soft and translucent, about 3 minutes.

  4. 4

    Pour in the cider and use a wooden spoon to scrape up any stuck-on bits from the bottom of the pan, then let it bubble gently for 2 minutes so some of the sharp flavor cooks off.

  5. 5

    Nestle the fish pieces into the liquid so they are partly submerged, then cover the pan with a lid or foil and simmer over medium heat for 4 minutes, until the fish is opaque at the edges.

  6. 6

    Scatter the mussels and shrimp around and on top of the fish, cover again, and simmer for 3 minutes, until the mussels start to open and the shrimp turns pink and opaque throughout.

  7. 7

    Pour in the heavy cream and stir gently from bottom to top to combine it with the broth without breaking up the fish, then simmer uncovered for 1 minute until heated through.

  8. 8

    Remove from heat and discard any mussels that did not open, then taste the broth and add salt and pepper until it tastes balanced and flavorful.

  9. 9

    Sprinkle the chopped thyme and parsley over the top of the stew, then ladle it into bowls, making sure each bowl gets some fish, shellfish, and broth.

Tools you’ll need

  • 12-inch skillet or shallow Dutch oven with lid
  • cutting board
  • chef's knife
  • wooden spoon
  • measuring cups
  • paper towels
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.