Mushroom Rice Bowl
A comforting bowl of steamed rice topped with savory sliced mushrooms, fresh green onions, and tangy shredded red ginger. Simple, quick, and full of umami.
- Total time
- 15 min
- Servings
- 2
- Calories
- 350
- Protein
- 8g
comfortingJapaneseveganvegetariandairy-freemushroomtenderchewy
Ingredients
- 2 cups cooked rice
- 2 cups sliced mushrooms
- 2 tablespoons soy sauce
- 1 tablespoon mirin
- 1 tablespoon vegetable oil
- 2 stalks green onions
- 2 tablespoons shredded red ginger
- ¼ teaspoon salt
- ¼ teaspoon black pepper
Instructions
- 1
Heat oil in a skillet over medium-high heat.
- 2
Add sliced mushrooms and cook until browned, about 5 minutes.
- 3
Stir in soy sauce, mirin, salt, and pepper; cook for 1 minute.
- 4
Divide warm rice between two bowls.
- 5
Top each bowl with the mushroom mixture.
- 6
Garnish with sliced green onions and shredded red ginger.
Tools you’ll need
- skillet
- spatula
- knife
- cutting board
- measuring cups
- measuring spoons
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
