Marmalade Toast
Crispy buttered toast topped with bright, bitter-sweet orange marmalade. The perfect quick breakfast or snack to pair with your morning espresso.
- Total time
- 5 min
- Servings
- 1
- Calories
- 165
- Protein
- 3g
quicksimpleamericanvegetariancrispysoftweeknightbrunch
Ingredients
- 1 slice bread
- ½ tbsp butter
- 1 tbsp orange marmalade
Instructions
- 1
Toast the bread until golden brown and crispy, about 2–3 minutes.
- 2
Spread butter over the hot toast while it's still warm.
- 3
Top with a generous spread of orange marmalade.
- 4
Serve immediately alongside your espresso.
Tools you’ll need
- toaster
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
