CookSnap is coming soon — Join the waitlist →

Lebanese Cheese Manoushe

Crispy-bottomed flatbread topped with melted cheese and fresh herbs, ready in under 20 minutes. A beloved Lebanese street food you can make at home with pantry staples and simple technique.

Total time
18 min
Servings
2
Calories
485
Protein
16g
Lebanese Cheese Manoushe
casualquickmiddle-easternvegetariancrispymeltyfluffyweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • ¾ cup whole milk yogurt
  • 1 cup shredded white cheese (feta, akkawi, or mozzarella blend)
  • 3 tablespoons fresh mint leaves, finely chopped
  • ½ teaspoon baking powder
  • 3 tablespoons olive oil

Instructions

  1. 1

    Pour 1.5 cups flour, 0.75 cup yogurt, and 0.5 teaspoon baking powder into a large bowl.

  2. 2

    Stir with a wooden spoon for 2 minutes until shaggy dough forms with no dry flour streaks visible at the bottom of the bowl.

  3. 3

    Knead the dough inside the bowl with your hands, pressing and folding for 1 minute until smooth and slightly sticky to the touch.

  4. 4

    Divide the dough into 2 equal pieces and shape each into a ball by pinching the bottom and rolling under your palm.

  5. 5

    Mix 1 cup shredded cheese and 3 tablespoons chopped mint in a small bowl until evenly combined.

  6. 6

    Heat a 12-inch nonstick skillet or cast iron pan over medium-high heat until oil placed in the center shimmers and slides quickly, about 90 seconds.

  7. 7

    Place one dough ball on a lightly oiled work surface and, using your fingertips, press and stretch it into a thin circle about 7 inches across and 1/8 inch thick.

  8. 8

    Slide the stretched dough into the hot skillet and cook for 2 minutes without moving it until the bottom turns golden brown and you smell a toasted aroma.

  9. 9

    Flip the dough using a flat spatula, then immediately sprinkle half of the cheese-mint filling evenly over the surface.

  10. 10

    Cook for 1.5 minutes until the bottom is golden and the cheese is beginning to melt, then transfer to a plate.

  11. 11

    Repeat steps 7–10 with the second dough ball and remaining filling.

  12. 12

    Cut each manoushe in half and serve warm while the cheese is still melted.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • small mixing bowl
  • 12-inch nonstick skillet or cast iron pan
  • flat spatula
  • work surface
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.