CookSnap is coming soon — Join the waitlist →
Back to recipes

Pan-Seared Kielbasa with Cabbage & Mustard

Polish-style kielbasa seared until golden and served with buttery braised cabbage and a sharp mustard finish. One skillet, 20 minutes, pure comfort.

Total time
20 min
Servings
4
Calories
520
Protein
28g
Pan-Seared Kielbasa with Cabbage & Mustard
comfortcasualpolishporkcrispytenderweeknightmain-dish

Ingredients

  • 1.5 lbs biała kiełbasa (Polish white sausage), sliced into 1/2-inch rounds
  • ½ head green cabbage, thinly sliced
  • 1 medium yellow onion, thinly sliced
  • 3 tbsp butter
  • 3 tbsp whole-grain mustard
  • ½ tsp caraway seeds

Instructions

  1. 1

    Heat a large skillet over medium-high heat. Working in batches, sear kielbasa rounds 2 minutes per side until golden and crispy. Set aside on a plate.

  2. 2

    Reduce heat to medium. Add butter and sauté onion until softened, about 3 minutes, stirring occasionally.

  3. 3

    Add cabbage and caraway seeds. Season with salt and pepper. Cook uncovered, stirring every 2 minutes, until cabbage is tender, about 6 minutes.

  4. 4

    Return kielbasa to the skillet. Stir in mustard until everything is coated and warmed through, about 90 seconds.

  5. 5

    Serve hot straight from the skillet with crusty bread if desired.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Polish recipes →