Kaymak Toast with Balkan Sides
Creamy, rich kaymak spread on warm toast, served with fresh tomatoes, cucumbers, olives, and tea. A simple Balkan breakfast or light dinner that feels elegant but takes just minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 340
- Protein
- 8g

simpleelegantbalkanvegetariancreamycrispyweeknightbrunch
Ingredients
- ½ cup kaymak (or clotted cream)
- 4 slices bread (sourdough or crusty white)
- 2 medium tomatoes
- 1 medium cucumber
- ½ cup black olives (pitted)
- 2 cups tea (brewed, hot)
Instructions
- 1
Toast the bread until golden and crispy, about 2–3 minutes per side.
- 2
Slice the tomatoes and cucumber into 1/4-inch rounds.
- 3
Spread a generous layer of kaymak onto each warm toast slice.
- 4
Arrange tomato slices, cucumber rounds, and olives on a plate alongside the toast.
- 5
Serve immediately with a cup of hot tea.
Tools you’ll need
- toaster or toaster oven
- cutting board
- serrated knife
- butter knife
- plate
- kettle
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



