CookSnap is coming soon — Join the waitlist →

Honey Roasted Chicken with Root Vegetables

Vietnamese-inspired sheet-pan dinner with caramelized honey-glazed chicken thighs and roasted potatoes, carrots, and zucchini. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
42g
Honey Roasted Chicken with Root Vegetables
comfortsatisfyingvietnamesechickencrispytendercaramelizedweeknight

Ingredients

  • 4 pieces (about 1.5 lbs) chicken thighs, skin-on and bone-in
  • 3 tbsp honey
  • 2 tbsp soy sauce
  • 8 oz baby potatoes, halved
  • 2 medium carrots, cut into 1-inch pieces
  • 1 medium zucchini, cut into 1-inch chunks

Instructions

  1. 1

    Pat chicken thighs dry with paper towels. Season all sides generously with salt and pepper.

  2. 2

    Whisk honey and soy sauce together in a small bowl until combined.

  3. 3

    Arrange potatoes, carrots, and zucchini on a sheet pan. Drizzle with 1 tbsp oil, toss, and push to the sides.

  4. 4

    Place chicken thighs skin-side up in the center of the pan. Brush with honey-soy mixture.

  5. 5

    Roast at 425°F until chicken skin is dark golden and an instant-read thermometer reads 165°F at the thickest part, 12–14 minutes.

  6. 6

    Serve chicken and vegetables hot, drizzling any pan juices over the top.

Tools you’ll need

  • sheet pan (18×13 inch)
  • instant-read thermometer
  • small mixing bowl
  • measuring spoons
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.