CookSnap is coming soon — Join the waitlist →
Back to recipes

Honey Garlic Chicken Sheet Pan

Caramelized chicken thighs with roasted potatoes, garlicky greens, and whole garlic cloves in one sheet pan. Sweet, savory, and ready in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
38g
Honey Garlic Chicken Sheet Pan
comfortsatisfyingvietnamesechickencrispytendercaramelizedweeknight

Ingredients

  • 1.2 lb chicken thighs, skin-on boneless
  • 3 tbsp honey
  • ¾ lb potatoes, 1-inch cubes
  • 8 cloves garlic cloves, peeled whole
  • 4 cups mixed greens (spinach, bok choy, or Chinese broccoli)
  • 1 tbsp fish sauce

Instructions

  1. 1

    Toss potatoes with 1 tbsp oil, salt, and pepper on a sheet pan. Spread in a single layer and roast at 425°F.

  2. 2

    Mix honey, fish sauce, and 1 tbsp oil in a small bowl. Season chicken thighs with salt and pepper on both sides.

  3. 3

    After 8 minutes, push potatoes to the sides and add chicken thighs skin-side up in the center with whole garlic cloves.

  4. 4

    Brush honey mixture over chicken thighs. Roast for 10 more minutes until skin is caramelized and chicken reaches 165°F.

  5. 5

    Toss greens with 1 tbsp oil and a pinch of salt. Scatter over the pan in the last 1 minute of cooking.

  6. 6

    Serve hot straight from the pan, dividing chicken, potatoes, greens, and garlic cloves between plates.

Tools you’ll need

  • sheet pan (18x13 inch)
  • small bowl
  • instant-read thermometer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →