CookSnap is coming soon — Join the waitlist →
Back to recipes

Honey Roasted Chicken with Cucumber

Sticky-glazed chicken thighs with a bright honey-soy coating, roasted until caramelized and served with cool cucumber slices. Ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
38g
Honey Roasted Chicken with Cucumber
satisfyingcasualvietnamesechickencrispytenderjuicyweeknight

Ingredients

  • 4 thighs (about 1.5 lbs) boneless, skinless chicken thighs
  • 3 tbsp honey
  • 2 tbsp soy sauce
  • ½ tbsp fish sauce
  • 3 cloves garlic, minced
  • 1 medium cucumber, thinly sliced

Instructions

  1. 1

    Pat chicken dry with paper towels. Season both sides generously with salt and black pepper.

  2. 2

    Whisk honey, soy sauce, fish sauce, and minced garlic in a small bowl until combined.

  3. 3

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  4. 4

    Sear chicken thighs 3–4 minutes per side without moving until golden brown on both sides.

  5. 5

    Pour honey-soy glaze over chicken. Reduce heat to medium and cook 5–6 minutes until glaze thickens and coats the meat.

  6. 6

    Serve chicken hot, topped with pan glaze, alongside cool cucumber slices.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →