CookSnap is coming soon — Join the waitlist →
Back to recipes

Harissa Fish with Rice & Roasted Sides

Spiced harissa-roasted fish fillet with fluffy seasoned rice, roasted sweet potato wedges, and bitter melon—all prepped on one sheet pan for a warming Moroccan dinner.

Total time
28 min
Servings
2
Calories
520
Protein
38g
Harissa Fish with Rice & Roasted Sides
comfortheartymoroccanfishtendercrispyweeknightdinner

Ingredients

  • 2 fillets (6 oz each) firm white fish fillets (cod, halibut, or sea bass)
  • 3 tbsp harissa paste
  • 1 medium sweet potato, cut into wedges
  • 1 whole bitter melon, halved lengthwise and seeded
  • 1 whole red bell pepper, cut into strips
  • 1 cup long-grain white rice
  • ½ tsp cumin seeds
  • 1 whole lemon

Instructions

  1. 1

    Start rice in a pot with 2 cups salted water. Bring to boil, then cover and reduce heat to low.

  2. 2

    Toss sweet potato wedges and bitter melon halves with 2 tbsp oil, salt, and pepper. Spread on a large sheet pan.

  3. 3

    Roast vegetables at 425°F for 12 minutes until sweet potato begins to soften.

  4. 4

    Pat fish dry. Mix harissa with 1 tbsp oil and a pinch of salt. Coat both sides of fillets.

  5. 5

    Push roasted vegetables to the sides of the pan. Lay fish in the center, scatter bell pepper strips around it.

  6. 6

    Roast 10–12 minutes more until fish flakes easily and edges of vegetables crisp.

  7. 7

    Toast cumin seeds in a dry skillet 30 seconds, then stir into cooked rice. Squeeze lemon over fish.

  8. 8

    Plate rice, fish, and roasted vegetables together. Serve immediately.

Tools you’ll need

  • medium pot with lid
  • large sheet pan (13×18 inch)
  • small skillet
  • cutting board
  • knife
  • measuring spoons
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Moroccan recipes →