CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Beef Carne Seca

Shredded beef crisped hard in a hot skillet with chiles and cumin—the weeknight version of northern Mexico's legendary dried-beef dish. Ready in under 20 minutes with pantry shortcuts.

Total time
18 min
Servings
3
Calories
385
Protein
38g
Crispy Beef Carne Seca
comfortheartymexicanbeefcrispytenderweeknightmain-dish

Ingredients

  • 1.25 lbs shredded cooked beef (rotisserie or leftover)
  • 2 whole dried chile de árbol or guajillo, stemmed and seeded
  • 1.5 tsp cumin
  • 1 whole lime
  • ½ medium white onion, thinly sliced
  • 1 whole jalapeño, sliced

Instructions

  1. 1

    Toast dried chiles in a dry skillet over medium heat for 90 seconds until fragrant. Remove and let cool, then crumble by hand into small pieces.

  2. 2

    Heat 2 tbsp olive oil in the same skillet over medium-high until shimmering. Add onion and jalapeño, stir for 2 minutes until softened.

  3. 3

    Add shredded beef, crumbled chile, and cumin. Stir constantly, breaking up clumps, for 6-8 minutes until beef is golden and crispy on edges.

  4. 4

    Squeeze half the lime over the beef. Season with salt and pepper to taste. Toss once and slide onto a plate.

  5. 5

    Cut remaining lime into wedges. Serve the carne seca with lime wedges and warm tortillas.

Tools you’ll need

  • 12-inch skillet or comal
  • wooden spoon or spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.