CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Memela with Crispy Tasajo

Thick Oaxacan corn cakes topped with crispy shredded dried beef, black beans, and fresh lime. Salty, smoky, and satisfying—ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
18g
25-Min Memela with Crispy Tasajo
comfortrusticmexicanbeefcrispyheartytenderweeknight

Ingredients

  • 3 oz tasajo (dried shredded beef)
  • 1 cup masa harina (corn flour for tortillas)
  • ¾ cup warm water
  • ½ can (15 oz) canned black beans, drained
  • ½ medium white onion, thinly sliced
  • 1 whole lime
  • 2 whole jalapeños, thinly sliced (optional)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering.

  2. 2

    Add tasajo to the skillet and cook, stirring often, until it's crispy and darkens, 5–6 minutes.

  3. 3

    Transfer tasajo to a plate. Mix masa harina with warm water in a bowl until smooth.

  4. 4

    Working in batches, pour 3 tbsp masa into the skillet and flatten into a thick disc with a spatula.

  5. 5

    Cook memela 3–4 minutes per side until golden, working in batches. Transfer to a plate.

  6. 6

    Top each memela with black beans, crispy tasajo, raw onion, jalapeño, and a squeeze of fresh lime.

Tools you’ll need

  • large skillet (12-inch)
  • mixing bowl
  • spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Mexican recipes →