CookSnap is coming soon — Join the waitlist →
Back to recipes

Grilled Veggie Hummus Wrap with Tahini Drizzle

Warm tortillas loaded with store-bought hummus, char-grilled zucchini and bell peppers, crisp greens, and a drizzle of tahini-lemon sauce. Ready in under 15 minutes—weeknight Mediterranean comfort food.

Total time
15 min
Servings
2
Calories
380
Protein
13g
Grilled Veggie Hummus Wrap with Tahini Drizzle
freshquickcasualmediterraneanvegetarianveganchickpeascrispy

Ingredients

  • 2 count large flour tortillas (or spinach wraps)
  • ¾ cup hummus
  • 1 medium, sliced lengthwise 1/4-inch thick zucchini
  • 1 large, cut into 3-inch strips bell pepper (any color)
  • 1 cup, lightly packed fresh spinach or arugula
  • 2 tbsp tahini
  • ½ count lemon (juiced)

Instructions

  1. 1

    Heat a grill pan or skillet over medium-high heat until hot, about 1 minute.

  2. 2

    Brush zucchini and bell pepper with oil, salt, and pepper. Grill 2-3 minutes per side until charred and tender.

  3. 3

    Warm tortillas directly over the flame (or in the skillet 30 seconds per side) until pliable.

  4. 4

    Whisk tahini and lemon juice with 1 tbsp water until smooth; season with salt and pepper.

  5. 5

    Spread 3 tbsp hummus on each tortilla, then layer spinach, grilled vegetables, and extra veggies if desired.

  6. 6

    Drizzle tahini sauce over filling, roll tightly, cut in half, and serve immediately with extra sauce on the side.

Tools you’ll need

  • grill pan or 12-inch skillet
  • pastry brush
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Mediterranean recipes →