Custrd is out on the App Store — Download it free →
Back to recipes

Greek Village Salad

Crisp tomatoes, cucumbers, olives, and creamy feta tossed with a punchy olive-oil-and-vinegar dressing. This is the real deal—no lettuce, just the good stuff.

Total time
15 min
Servings
4
Calories
285
Protein
8g
Greek Village Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into chunks, removing excess seeds. Cut cucumber into half-moons.

  2. Step 2

    Thinly slice the red onion and place in a large bowl with tomatoes, cucumber, and olives.

  3. Step 3

    Whisk olive oil and red wine vinegar in a small bowl. Add a pinch of salt and black pepper.

  4. Step 4

    Pour dressing over salad and toss gently to coat, about 20 times.

  5. Step 5

    Top with crumbled feta cheese and a crack of black pepper. Serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • large bowl
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.