CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Classic Greek Salad

A bright, tangy Mediterranean salad with crisp vegetables, creamy feta, and briny olives tossed in a simple lemon-oregano dressing. Ready in 15 minutes with no cooking required.

Total time
15 min
Servings
4
Calories
285
Protein
8g
Classic Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

  • 4 medium Roma tomatoes
  • 1 whole English cucumber
  • ½ medium red onion
  • 1 cup Kalamata olives, pitted
  • 8 oz feta cheese, crumbled
  • ¼ cup olive oil
  • 3 tablespoon lemon juice
  • 1 teaspoon dried oregano
  • 0 to taste salt and pepper

Instructions

  1. 1

    Hold a Roma tomato stem-side up on the cutting board and slice it straight down through the center from top to bottom into quarters, creating four wedge-shaped pieces; repeat with remaining tomatoes.

  2. 2

    Place the cucumber on the cutting board and slice it lengthwise from end to end into two long halves, then cut each half crosswise into half-moons about 1/4-inch thick—like coins.

  3. 3

    Cut the red onion in half from root to tip, place the flat side down on the cutting board, and slice it crosswise into thin half-rings about 1/8-inch wide, starting from one end.

  4. 4

    Pour the olive oil into a small bowl, then add 3 tablespoons of lemon juice and 1 teaspoon of dried oregano; whisk with a fork for 10 seconds until the mixture looks emulsified and uniform.

  5. 5

    Add the tomato wedges, cucumber slices, and red onion rings to a large bowl, then scatter the Kalamata olives and crumbled feta cheese on top.

  6. 6

    Pour the lemon-oregano dressing over the salad, then toss everything together with two large spoons or salad forks, turning and lifting until the dressing coats all the vegetables and cheese evenly.

  7. 7

    Taste the salad, then sprinkle with salt and pepper a pinch at a time until it tastes the way you like it—not too salty, as the feta and olives already add saltiness.

Tools you’ll need

  • cutting board
  • chef's knife
  • small mixing bowl
  • fork
  • large serving bowl
  • salad forks or large spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.