Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Feta Greek Salad

Juicy tomatoes, crisp cucumbers, and briny olives tossed with a tangy lemon dressing and topped with salty feta. A 10-minute salad that tastes like a vacation in a bowl.

Total time
10 min
Servings
2
Calories
245
Protein
7g
Crispy Feta Greek Salad
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes in half lengthwise, then into thick wedges so they hold their shape.

  2. Step 2

    Cut cucumber into 1/2-inch chunks and add to a large bowl with tomatoes and olives.

  3. Step 3

    Whisk together lemon juice, olive oil, and a pinch each of salt and pepper in a small bowl.

  4. Step 4

    Pour dressing over vegetables and toss gently until coated, about 30 seconds.

  5. Step 5

    Top with feta cubes and a few grinds of black pepper. Serve immediately.

Tools you’ll need

  • chef's knife
  • cutting board
  • large bowl
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.