CookSnap is coming soon — Join the waitlist →

Crispy Feta Horiatiki Salad

Juicy tomatoes, cool cucumbers, briny olives, and creamy feta tossed in a lemon-oregano dressing. Crisp, fresh, and ready in under 15 minutes.

Total time
15 min
Servings
2
Calories
285
Protein
8g
Crispy Feta Horiatiki Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

  • 3 medium tomatoes, ripe and firm
  • 1 whole cucumber, English or Persian
  • ¾ cup Kalamata olives, pitted
  • 6 oz feta cheese, block
  • ¼ medium red onion, thinly sliced
  • 1 whole lemon, fresh
  • 1 tbsp dried oregano

Instructions

  1. 1

    Halve tomatoes and scoop out seeds with your fingers. Chop tomatoes into bite-sized chunks.

  2. 2

    Cut cucumber in half lengthwise, then chop into half-moons about 1/2 inch thick.

  3. 3

    Tear feta into large chunks with your hands (don't crumble). Add tomatoes, cucumber, olives, and red onion to a bowl.

  4. 4

    Squeeze lemon juice over the salad. Drizzle with 2 tbsp olive oil. Sprinkle oregano and a pinch of salt.

  5. 5

    Toss gently with your hands so feta breaks into smaller pieces and dressing coats everything.

  6. 6

    Serve immediately while tomatoes are juicy and feta is creamy.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.