Custrd is out on the App Store — Download it free →
Back to recipes

Horiatiki — Smashed Greek Salad

Juicy tomatoes, crisp cucumber, creamy feta, and briny olives tossed with a lemon-olive oil dressing and crushed red pepper. A no-cook Mediterranean classic that tastes even better when the vegetables are lightly smashed to release their juices.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Horiatiki — Smashed Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freedairy-free

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into rough chunks. Cut cucumber into 1-inch pieces. Place both in a large bowl.

  2. Step 2

    Add olives, red onion, and feta. Pour olive oil and lemon juice over everything.

  3. Step 3

    Sprinkle oregano and a pinch of salt and pepper over the salad.

  4. Step 4

    Gently toss with your hands or a spoon, lightly pressing to release tomato juices, about 20 seconds.

  5. Step 5

    Let sit for 2 minutes so flavors meld, then taste and adjust seasoning.

  6. Step 6

    Serve immediately with crusty bread or warm pita if desired.

Tools you’ll need

  • large mixing bowl
  • knife
  • cutting board
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.