CookSnap is coming soon — Join the waitlist →
Back to recipes

Horiatiki — Smashed Greek Salad

Juicy tomatoes, crisp cucumber, creamy feta, and briny olives tossed with a lemon-olive oil dressing and crushed red pepper. A no-cook Mediterranean classic that tastes even better when the vegetables are lightly smashed to release their juices.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Horiatiki — Smashed Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freedairy-free

Ingredients

  • 2 medium ripe tomatoes (Roma or beefsteak)
  • 1 large cucumber
  • ¾ cup feta cheese, crumbled
  • ½ cup Kalamata olives, pitted
  • ¼ cup red onion, thinly sliced
  • 3 tbsp extra-virgin olive oil
  • 2 tbsp lemon juice (about 1 lemon)
  • ½ tsp dried oregano

Instructions

  1. 1

    Cut tomatoes into rough chunks. Cut cucumber into 1-inch pieces. Place both in a large bowl.

  2. 2

    Add olives, red onion, and feta. Pour olive oil and lemon juice over everything.

  3. 3

    Sprinkle oregano and a pinch of salt and pepper over the salad.

  4. 4

    Gently toss with your hands or a spoon, lightly pressing to release tomato juices, about 20 seconds.

  5. 5

    Let sit for 2 minutes so flavors meld, then taste and adjust seasoning.

  6. 6

    Serve immediately with crusty bread or warm pita if desired.

Tools you’ll need

  • large mixing bowl
  • knife
  • cutting board
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →