CookSnap is coming soon — Join the waitlist →
Back to recipes

Golden Waffles with Whipped Cream & Strawberries

Crispy-outside, fluffy-inside waffles topped with fresh whipped cream and juicy strawberries. Ready in 20 minutes with a standard waffle iron.

Total time
20 min
Servings
2
Calories
520
Protein
12g
Golden Waffles with Whipped Cream & Strawberries
indulgentcasualamericanvegetarianeggscrispyfluffycreamy

Ingredients

  • 1.5 cups all-purpose flour
  • 2 large eggs
  • 1.25 cups milk
  • ½ cup heavy cream
  • 1 lb fresh strawberries
  • 2 tbsp granulated sugar
  • 2 tsp baking powder

Instructions

  1. 1

    Preheat waffle iron. Whisk flour, baking powder, and a pinch of salt in a bowl.

  2. 2

    Whisk eggs and milk together, then fold into flour mixture until just combined—some lumps are fine.

  3. 3

    Pour batter into waffle iron until 3/4 full. Cook until golden and crispy, ~4 minutes per waffle.

  4. 4

    While waffles cook, whip heavy cream with 1 tbsp sugar until soft peaks form.

  5. 5

    Hull strawberries, slice in half, and toss with 1 tbsp sugar to release juice.

  6. 6

    Stack warm waffles on plates, top with whipped cream and strawberries, and serve immediately.

Tools you’ll need

  • waffle iron
  • medium mixing bowl
  • whisk
  • measuring cups and spoons
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all American recipes →