Golden Sesame Pide with Honey Butter
Crispy, pillowy flatbread brushed with melted butter and drizzled with warm honey, served with juicy cherry tomatoes. Turkish comfort in 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 385
- Protein
- 8g

cozycomfortturkishvegetarianvegetariancrispyfluffyweeknight
Ingredients
- 2 pieces naan or pita bread (store-bought, large)
- 3 tbsp butter, divided
- 2 tbsp sesame seeds
- 3 tbsp honey
- 1 cup cherry tomatoes
- ¼ tsp fleur de sel or flaky sea salt
Instructions
- 1
Preheat oven to 450°F. Line a sheet pan with parchment paper.
- 2
Place naan on the sheet pan. Melt 2 tbsp butter and brush generously over the top.
- 3
Scatter sesame seeds evenly across the buttered bread, pressing gently.
- 4
Bake 7–8 minutes until edges are golden and sesame seeds smell nutty.
- 5
Warm honey with remaining 1 tbsp butter in a small pan, ~90 seconds over low heat.
- 6
Drizzle honey-butter over warm pide. Serve with halved tomatoes sprinkled with fleur de sel.
Tools you’ll need
- sheet pan
- parchment paper
- pastry brush
- small saucepan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

