Girl Dinner Board
A no-cook snack plate loaded with cheese, cured meats, pickles, olives, and crispy crackers — the ultimate "I'm not cooking" dinner. Mix and match everything for endless bites.
- Total time
- 10 min
- Servings
- 2
- Calories
- 380
- Protein
- 16g
casualsimplecheesecrispycreamyweeknightcasualappetizer
Ingredients
- 6 oz mixed cheese (cheddar, brie, or gouda), sliced or cubed
- 4 oz cured meats (salami, prosciutto, or sopressata), sliced
- 1 cup mixed olives and pickles (cornichons, pepperoncini)
- 2 cups crackers (water crackers, seeded, or breadsticks)
- 1.5 cups fresh fruit (grapes, apple slices, or berries)
- 2 tbsp hot honey or whole-grain mustard
Instructions
- 1
Arrange cheese, cured meats, olives, and pickles on a board or large plate.
- 2
Scatter crackers and fresh fruit around the board, filling in gaps.
- 3
Drizzle hot honey over the cheese or dollop mustard on the side as a dip.
- 4
Serve immediately and mix and match as you eat.
Tools you’ll need
- cutting board or serving platter
- small sharp knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
