Horiatiki: Greek Village Salad with Barley Rusks
Juicy tomatoes, crisp cucumber, creamy feta, and briny olives tossed with a sharp lemon-olive oil dressing. Serve with chewy barley rusks for dipping.
- Total time
- 15 min
- Servings
- 2
- Calories
- 285
- Protein
- 8g
freshlightsimplegreekvegetariangluten-freecheesecrispy
Ingredients
- 3 whole tomatoes (ripe, large)
- 1 whole cucumber (English or Persian)
- 6 oz feta cheese, crumbled
- ¾ cup Kalamata olives, pitted
- ¼ cup red onion, thinly sliced
- 3 tbsp olive oil
- 2 tbsp lemon juice
- 4 whole barley rusks (paximadi)
Instructions
- 1
Cut tomatoes into bite-sized chunks, removing excess seeds and juice. Transfer to a bowl.
- 2
Cut cucumber into half-moons about 1/4-inch thick. Add to the bowl with tomatoes.
- 3
Add olives, red onion, and crumbled feta to the bowl.
- 4
Whisk together olive oil and lemon juice with a pinch of salt and black pepper.
- 5
Pour dressing over the salad and toss gently until everything is coated.
- 6
Divide between plates or bowls. Serve immediately with barley rusks for dipping.
Tools you’ll need
- cutting board
- sharp knife
- large bowl
- small bowl
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
