Custrd is out on the App Store — Download it free →
Back to recipes

Greek Village Salad with Tzatziki

Crisp tomatoes, cucumbers, olives, and creamy feta tossed with a bright olive oil and vinegar dressing, served with cool tzatziki on the side. No cooking required—just chop, toss, and pour a glass of rosé.

Total time
10 min
Servings
2
Calories
340
Protein
12g
Greek Village Salad with Tzatziki
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

  • 3 medium tomatoes (Roma or heirloom)
  • 1 large cucumber
  • 1 cup Kalamata olives, pitted
  • 200 g feta cheese, crumbled
  • 3 tbsp olive oil
  • 1 tbsp red wine vinegar
  • ½ cup tzatziki

Instructions

  1. 1

    Core the tomatoes and chop them into 1-inch chunks. Cut the cucumber into half-moons about 1/4-inch thick.

  2. 2

    Transfer tomatoes and cucumber to a large bowl. Add the Kalamata olives and crumbled feta.

  3. 3

    Drizzle with olive oil and red wine vinegar. Season with salt and pepper to taste, then toss gently until just coated.

  4. 4

    Divide the salad between two plates. Dollop tzatziki on the side and serve immediately with rosé.

Tools you’ll need

  • large mixing bowl
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.