Greek Village Salad with Tzatziki
Crisp tomatoes, cucumbers, olives, and creamy feta tossed with a bright olive oil and vinegar dressing, served with cool tzatziki on the side. No cooking required—just chop, toss, and pour a glass of rosé.
- Total time
- 10 min
- Servings
- 2
- Calories
- 340
- Protein
- 12g

freshlightsimplegreekvegetariangluten-freecheesecrispy
Ingredients
- 3 medium tomatoes (Roma or heirloom)
- 1 large cucumber
- 1 cup Kalamata olives, pitted
- 200 g feta cheese, crumbled
- 3 tbsp olive oil
- 1 tbsp red wine vinegar
- ½ cup tzatziki
Instructions
- 1
Core the tomatoes and chop them into 1-inch chunks. Cut the cucumber into half-moons about 1/4-inch thick.
- 2
Transfer tomatoes and cucumber to a large bowl. Add the Kalamata olives and crumbled feta.
- 3
Drizzle with olive oil and red wine vinegar. Season with salt and pepper to taste, then toss gently until just coated.
- 4
Divide the salad between two plates. Dollop tzatziki on the side and serve immediately with rosé.
Tools you’ll need
- large mixing bowl
- cutting board
- chef's knife
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



