CookSnap is coming soon — Join the waitlist →
Back to recipes

Horiatiki — Crispy Feta Greek Salad

The ultimate TikTok salad: juicy tomatoes, snappy cucumber, briny olives, and a slab of crispy pan-fried feta that steals the show. Five minutes of prep, zero cooking required except the feta.

Total time
12 min
Servings
2
Calories
320
Protein
12g
Horiatiki — Crispy Feta Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

  • 8 oz feta cheese block
  • 1 lb ripe tomatoes
  • 1 medium cucumber
  • ¾ cup Kalamata olives
  • ¼ medium red onion
  • 3 tbsp olive oil
  • 1.5 tbsp red wine vinegar
  • ½ tsp dried oregano

Instructions

  1. 1

    Cut tomatoes into wedges and cucumber into thick half-moons. Slice red onion paper-thin.

  2. 2

    Heat 1 tbsp olive oil in a skillet over medium-high heat until shimmering.

  3. 3

    Cut feta into a 1-inch-thick slab. Sear it 90 seconds per side until edges turn golden and crispy.

  4. 4

    Arrange tomatoes, cucumber, onion, and olives on a plate. Whisk remaining 2 tbsp oil with vinegar and oregano.

  5. 5

    Drizzle dressing over vegetables. Top with the crispy feta slab and serve immediately.

Tools you’ll need

  • chef's knife
  • cutting board
  • 10-inch skillet
  • small bowl
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →