Greek Village Salad with Crispy Feta
Tomato, cucumber, olives, and creamy feta tossed with a bright lemon-olive oil dressing. Ready in 10 minutes — no cooking required, just chopping and tossing.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 8g

freshlightsimplegreekmediterraneanvegetariangluten-freecheese
Ingredients
- 2 medium Roma tomatoes
- 1 medium English cucumber
- ¾ cup Kalamata olives
- 6 oz Feta cheese
- 1 whole Lemon
- 3 tbsp Olive oil
Instructions
- 1
Cut tomatoes into quarters. Slice cucumber into 1/2-inch rounds.
- 2
Tear feta into large chunks. Combine tomatoes, cucumber, olives, and feta in a bowl.
- 3
Squeeze lemon juice over the salad. Drizzle with olive oil, then season with salt and pepper.
- 4
Toss gently until everything is coated and the dressing pooled at the bottom looks glossy.
- 5
Let sit 2 minutes for flavors to meld, then serve at room temperature.
Tools you’ll need
- cutting board
- chef's knife
- large mixing bowl
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
More recipes like this
Craving more? Browse all Greek recipes →



