CookSnap is coming soon — Join the waitlist →
Back to recipes

Greek Village Salad with Crispy Feta

Tomato, cucumber, olives, and creamy feta tossed with a bright lemon-olive oil dressing. Ready in 10 minutes — no cooking required, just chopping and tossing.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Greek Village Salad with Crispy Feta
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

  • 2 medium Roma tomatoes
  • 1 medium English cucumber
  • ¾ cup Kalamata olives
  • 6 oz Feta cheese
  • 1 whole Lemon
  • 3 tbsp Olive oil

Instructions

  1. 1

    Cut tomatoes into quarters. Slice cucumber into 1/2-inch rounds.

  2. 2

    Tear feta into large chunks. Combine tomatoes, cucumber, olives, and feta in a bowl.

  3. 3

    Squeeze lemon juice over the salad. Drizzle with olive oil, then season with salt and pepper.

  4. 4

    Toss gently until everything is coated and the dressing pooled at the bottom looks glossy.

  5. 5

    Let sit 2 minutes for flavors to meld, then serve at room temperature.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →