Custrd is out on the App Store — Download it free →
Back to recipes

Garlic Cheddar Butter Biscuits

Flaky, buttery biscuits loaded with sharp cheddar and garlicky butter, ready in 15 minutes. Golden and crispy on the outside, tender inside—the only side dish you need.

Total time
15 min
Servings
8
Calories
310
Protein
8g
Garlic Cheddar Butter Biscuits
comfortsimplesouthernvegetarianflakycrispytenderBread

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Mix flour, cheddar, baking powder, and a pinch of salt in a bowl.

  2. Step 2

    Cut 6 tbsp cold butter into the flour mixture with your fingertips until it looks like coarse breadcrumbs.

  3. Step 3

    Stir in buttermilk until a shaggy dough forms. Do not overmix.

  4. Step 4

    Drop spoonfuls of dough onto a sheet pan, spacing them 2 inches apart. Bake until golden brown, 12-14 minutes.

  5. Step 5

    Melt remaining 2 tbsp butter with minced garlic in a small pan over low heat, 90 seconds—don't brown it.

  6. Step 6

    Brush hot biscuits with garlic butter immediately after they come out of the oven. Serve right away.

Tools you’ll need

  • mixing bowl
  • sheet pan
  • oven
  • small saucepan
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.