CookSnap is coming soon — Join the waitlist →
Back to recipes

Golden Cheddar Garlic Butter Biscuits

Flaky, buttery biscuits loaded with sharp cheddar and roasted garlic—ready in under 25 minutes. Perfect alongside soup, chili, or on their own as a carb-forward comfort bite.

Total time
22 min
Servings
6
Calories
285
Protein
7g
Golden Cheddar Garlic Butter Biscuits
comfortsimplesouthernvegetarianflakycrispytenderBread

Ingredients

  • 2 cups all-purpose flour
  • 1 tbsp baking powder
  • 6 tbsp cold butter, cubed
  • 1 cup sharp cheddar cheese, shredded
  • 4 clove garlic cloves, minced
  • ¾ cup whole milk
  • 2 tbsp butter, melted (for brushing)

Instructions

  1. 1

    Preheat oven to 400°F. Mix flour, baking powder, and a pinch of salt in a large bowl.

  2. 2

    Cut cold butter into the flour until the mixture looks like coarse sand with pea-sized crumbs.

  3. 3

    Fold in the cheddar and minced garlic until evenly distributed throughout the dough.

  4. 4

    Pour in the milk and stir gently until a shaggy dough just comes together—don't overmix.

  5. 5

    Drop spoonfuls onto a baking sheet, spacing 2 inches apart, then brush tops with melted butter.

  6. 6

    Bake for 14–16 minutes until tops are golden brown and a toothpick inserted comes out clean.

Tools you’ll need

  • large mixing bowl
  • baking sheet
  • spoon or ice cream scoop
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.