CookSnap is coming soon — Join the waitlist →

Golden Cheddar Garlic Butter Biscuits

Flaky, buttery biscuits loaded with sharp cheddar and roasted garlic—ready in under 25 minutes. Perfect alongside soup, chili, or on their own as a carb-forward comfort bite.

Total time
22 min
Servings
6
Calories
285
Protein
7g
Golden Cheddar Garlic Butter Biscuits
comfortsimplesouthernvegetarianflakycrispytenderweeknight

Ingredients

  • 2 cups all-purpose flour
  • 1 tbsp baking powder
  • 6 tbsp cold butter, cubed
  • 1 cup sharp cheddar cheese, shredded
  • 4 clove garlic cloves, minced
  • ¾ cup whole milk
  • 2 tbsp butter, melted (for brushing)

Instructions

  1. 1

    Preheat oven to 400°F. Mix flour, baking powder, and a pinch of salt in a large bowl.

  2. 2

    Cut cold butter into the flour until the mixture looks like coarse sand with pea-sized crumbs.

  3. 3

    Fold in the cheddar and minced garlic until evenly distributed throughout the dough.

  4. 4

    Pour in the milk and stir gently until a shaggy dough just comes together—don't overmix.

  5. 5

    Drop spoonfuls onto a baking sheet, spacing 2 inches apart, then brush tops with melted butter.

  6. 6

    Bake for 14–16 minutes until tops are golden brown and a toothpick inserted comes out clean.

Tools you’ll need

  • large mixing bowl
  • baking sheet
  • spoon or ice cream scoop
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.