CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Ful Medames Sandwich

Creamy Egyptian fava bean dip on warm pita, topped with fresh tomato, onion, and a drizzle of olive oil. Ready in 10 minutes—no cooking required.

Total time
10 min
Servings
2
Calories
380
Protein
14g
Ful Medames Sandwich
casualfreshegyptianmediterraneanvegetarianveganbeanscreamy

Ingredients

  • 1 can (15 oz) canned fava beans (ful), drained and rinsed
  • 3 tbsp olive oil
  • ½ whole lemon, juiced
  • 2 whole pita bread
  • 1 medium tomato, diced
  • ¼ whole red onion, thinly sliced

Instructions

  1. 1

    Mash fava beans with a fork until chunky-creamy, leaving some texture.

  2. 2

    Stir in 2 tbsp olive oil and lemon juice. Season with salt and pepper to taste.

  3. 3

    Warm pita in a dry skillet 30 seconds per side until soft and pliable.

  4. 4

    Spread ful mixture into each pita, dividing evenly between the two.

  5. 5

    Top with tomato and red onion. Drizzle remaining 1 tbsp olive oil over top.

  6. 6

    Serve immediately.

Tools you’ll need

  • fork
  • small bowl
  • 12-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.