Ful Medames Sandwich
Creamy Egyptian fava bean dip on warm pita, topped with fresh tomato, onion, and a drizzle of olive oil. Ready in 10 minutes—no cooking required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 380
- Protein
- 14g
casualfreshegyptianmediterraneanvegetarianveganbeanscreamy
Ingredients
- 1 can (15 oz) canned fava beans (ful), drained and rinsed
- 3 tbsp olive oil
- ½ whole lemon, juiced
- 2 whole pita bread
- 1 medium tomato, diced
- ¼ whole red onion, thinly sliced
Instructions
- 1
Mash fava beans with a fork until chunky-creamy, leaving some texture.
- 2
Stir in 2 tbsp olive oil and lemon juice. Season with salt and pepper to taste.
- 3
Warm pita in a dry skillet 30 seconds per side until soft and pliable.
- 4
Spread ful mixture into each pita, dividing evenly between the two.
- 5
Top with tomato and red onion. Drizzle remaining 1 tbsp olive oil over top.
- 6
Serve immediately.
Tools you’ll need
- fork
- small bowl
- 12-inch skillet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
