CookSnap is coming soon — Join the waitlist →

Falafel Wrap

Crispy store-bought falafel wrapped in soft pita with fresh vegetables, creamy tahini sauce, and bright lemon. Ready in 15 minutes with zero cooking required.

Total time
15 min
Servings
2
Calories
385
Protein
12g
Falafel Wrap
freshlightcasualmiddle-easternvegetarianveganchickpeascrispy

Ingredients

  • 8 pieces store-bought falafel (8–10 pieces, about 8 oz)
  • 3 tablespoons tahini
  • ½ whole lemon (juiced)
  • 2 tablespoons water
  • 2 whole large pita bread or flatbread
  • 1 whole tomato, thinly sliced
  • ½ whole cucumber, thinly sliced, and fresh herbs (parsley, cilantro, or mint, chopped)

Instructions

  1. 1

    Whisk tahini, lemon juice, and water in a small bowl until smooth and pourable.

  2. 2

    Heat falafel in a skillet or oven following package instructions until warm and crispy outside.

  3. 3

    Warm pita bread in the same skillet, flipping once, until soft and pliable, ~60 seconds.

  4. 4

    Spread tahini sauce across the inside of each pita, leaving a 1-inch border at the edges.

  5. 5

    Layer falafel, tomato slices, cucumber, and fresh herbs down the center of each wrap.

  6. 6

    Roll each wrap tightly, folding in the sides first, then rolling away from you.

  7. 7

    Wrap in foil or parchment to hold together. Serve immediately.

Tools you’ll need

  • small mixing bowl
  • whisk
  • 12-inch skillet or oven
  • tongs
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.