Custrd is out on the App Store — Download it free →
Back to recipes

Fried Small Fish

Crispy, golden whole small fish, simply seasoned and fried until crunchy. A quick and satisfying snack or light meal.

Total time
20 min
Servings
4
Calories
350
Protein
25g
Fried Small Fish
comfortingcasualspanishpescatarianfishcrispyweeknightparty

Ingredients

  • 1 pound small whole fish (like smelt or whitebait)
  • ½ cup all-purpose flour
  • 1 teaspoon salt
  • ½ teaspoon black pepper
  • 1 cup vegetable oil
  • 1 lemon lemon wedges

Instructions

  1. 1

    Rinse the 1 pound small fish and pat completely dry with paper towels. In a shallow dish, mix the 0.5 cup flour, 1 teaspoon salt, and 0.5 teaspoon black pepper.

  2. 2

    Heat the 1 cup vegetable oil in a large skillet over medium-high until shimmering, about 3 minutes. Test with a pinch of flour—it should sizzle immediately.

  3. 3

    Working in batches, dredge the fish in the seasoned flour, shaking off excess. Fry in a single layer without crowding, turning once, until golden and crisp, about 3-4 minutes per side.

  4. 4

    Transfer the fried fish to a paper-towel-lined plate to drain. Serve hot with the lemon wedges for squeezing over.

Tools you’ll need

  • large skillet
  • shallow dish
  • paper towels
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.