Fried Egg with Toast
A simple, satisfying breakfast of a crispy-edged fried egg served on buttered toast. Ready in minutes with ingredients you likely already have.
- Total time
- 5 min
- Servings
- 1
- Calories
- 220
- Protein
- 8g
comfortingquickamericanvegetarianeggcrispysoftweekday breakfast
Ingredients
- 1 large egg
- 1 slice bread
- 1 tbsp butter
- 1 pinch salt
- 1 pinch black pepper
Instructions
- 1
Melt 1/2 tbsp butter in a small nonstick skillet over medium heat. Crack the egg into the pan, being careful not to break the yolk.
- 2
Cook the egg for 2-3 minutes until the white is set and the edges are golden and crispy. Season with the salt and pepper.
- 3
While the egg cooks, toast the bread until golden and crisp. Spread the remaining 1/2 tbsp butter over the hot toast.
- 4
Slide the fried egg onto the buttered toast and serve immediately.
Tools you’ll need
- small nonstick skillet
- toaster or broiler
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
