CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Focaccia di Recco

Paper-thin, crispy layers of dough with melted cheese and herbs—a Ligurian classic. This stretched dough requires patience but rewards you with an addictively light, savory focaccia.

Total time
75 min
Servings
4
Calories
520
Protein
14g
Focaccia di Recco
rusticelegantitalianvegetariancheesecrispyflakymelty

Ingredients

  • 2 cups all-purpose flour
  • ½ tsp instant yeast
  • ¾ tsp salt
  • ¾ cup warm water
  • 4 tbsp olive oil
  • ½ lb stracchino or crescenza cheese, room temperature
  • 1 tbsp fresh rosemary, finely chopped
  • ¼ tsp black pepper

Instructions

  1. 1

    Mix flour, yeast, and salt in a large bowl. Pour warm water and 2 tbsp olive oil into the center.

  2. 2

    Stir with a wooden spoon until shaggy dough forms, then knead by hand until smooth, ~8 minutes.

  3. 3

    Oil a large bowl with remaining 2 tbsp olive oil. Place dough inside, cover with plastic wrap.

  4. 4

    Let rise in a warm place until doubled in size, 45–60 minutes, until you can see bubbles.

  5. 5

    Preheat oven to 400°F. Oil a 12-by-16-inch baking sheet generously with olive oil.

  6. 6

    Turn dough onto the oiled sheet. Gently stretch it with oiled hands until it covers the sheet.

  7. 7

    Tear stracchino into small pieces and scatter over dough. Sprinkle rosemary and black pepper.

  8. 8

    Fold dough in half over itself twice to create layers—don't worry if it tears slightly.

  9. 9

    Bake until the top is deep golden brown and edges are crispy, 18–22 minutes.

  10. 10

    Cool on the sheet for 3 minutes, then slide onto a wire rack or serving board.

  11. 11

    Drizzle with olive oil if desired. Serve warm or at room temperature.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • plastic wrap
  • 12-by-16-inch baking sheet
  • oven
  • wire rack or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.