CookSnap is coming soon — Join the waitlist →
Back to recipes

Greek Cheese & Herb Tiropita

Crispy phyllo pastry wrapped around creamy feta, ricotta, and fresh herbs. Baked until golden, it's an elegant vegetarian main that feels indulgent but comes together in under an hour.

Total time
50 min
Servings
4
Calories
420
Protein
16g
Greek Cheese & Herb Tiropita
elegantrusticgreekvegetariancheesecrispycreamyflaky

Ingredients

  • 8 sheets phyllo pastry sheets
  • 1.5 cups feta cheese, crumbled
  • 1 cup ricotta cheese
  • 3 tbsp fresh dill, chopped
  • 2 tbsp fresh parsley, chopped
  • 1 whole egg
  • 5 tbsp butter, melted
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Preheat oven to 375°F. Line a 9x13-inch baking dish with parchment paper.

  2. 2

    Mix feta, ricotta, dill, parsley, and egg in a bowl. Season with salt and pepper.

  3. 3

    Lay one phyllo sheet on a work surface. Brush lightly with melted butter.

  4. 4

    Spread 3 tbsp cheese filling along the bottom third of the phyllo sheet.

  5. 5

    Fold the bottom edge over the filling, then roll tightly like a burrito.

  6. 6

    Place seam-side down in the baking dish. Repeat with remaining phyllo and filling.

  7. 7

    Brush all rolls with remaining melted butter. Bake for 25 minutes until golden.

  8. 8

    Cool 5 minutes before serving. The pastry should crackle when you bite into it.

Tools you’ll need

  • 9x13-inch baking dish
  • parchment paper
  • mixing bowl
  • pastry brush
  • oven
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.