CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Feta & Spinach Pie (Tiropita)

Flaky phyllo wrapped around a warm, creamy feta and spinach filling. Ready in 25 minutes—crisp, salty, and deeply satisfying.

Total time
25 min
Servings
4
Calories
385
Protein
14g
Crispy Feta & Spinach Pie (Tiropita)
comfortrusticgreekvegetariancheesecrispycreamyflaky

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • 1.5 cups feta cheese, crumbled
  • 1 large egg
  • 8 sheets phyllo dough sheets (thawed)
  • ⅓ cup butter, melted
  • 2 tbsp fresh dill, chopped (or 1 tsp dried dill)

Instructions

  1. 1

    Preheat oven to 400°F. Mix spinach, feta, egg, and dill in a bowl until combined.

  2. 2

    Layer 4 phyllo sheets in a 8×8-inch baking dish, brushing each lightly with melted butter.

  3. 3

    Spread the spinach-feta filling over the phyllo layer in an even layer.

  4. 4

    Top with remaining 4 phyllo sheets, brushing each with butter. Score the top into 4 squares with a sharp knife.

  5. 5

    Bake until phyllo is golden and crispy, 12–15 minutes. Cool 2 minutes before cutting.

Tools you’ll need

  • 8×8-inch baking dish
  • medium mixing bowl
  • pastry brush
  • sharp knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.